PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr5g009460.1
Common NameMTR_5g009460
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family MYB_related
Protein Properties Length: 92aa    MW: 10715 Da    PI: 6.5415
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr5g009460.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding22.82.1e-073978445
                     S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding  4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45
                     ++++E++l+ +   + G + W++Ia +++ gR ++++  +w 
  Medtr5g009460.1 39 MSEQEEDLIRRMYDLVGDR-WNLIAGRIP-GRKAEEIERFWI 78
                     699**************99.*********.*********995 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007171.8E-43583IPR001005SANT/Myb domain
CDDcd001677.23E-53877No hitNo description
PfamPF002497.1E-73978IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.8E-104078IPR009057Homeodomain-like
SuperFamilySSF466891.61E-64078IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010091Biological Processtrichome branching
GO:0080147Biological Processroot hair cell development
GO:1900033Biological Processnegative regulation of trichome patterning
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 92 aa     Download sequence    Send to blast
MEEKRRSHSQ NKANISPNTS QTSEAGGEVS STEWEFIEMS EQEEDLIRRM YDLVGDRWNL  60
IAGRIPGRKA EEIERFWIMR HTDAFSAKRK K*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
137KRRSH
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFJ5550582e-53FJ555058.1 Glycine max transcription factor MYB363 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003611009.18e-62myb transcription factor
SwissprotQ8GV053e-30TRY_ARATH; Transcription factor TRY
SwissprotQ84RD13e-30ETC2_ARATH; MYB-like transcription factor ETC2
TrEMBLG7KAM19e-62G7KAM1_MEDTR; Myb transcription factor
STRINGGLYMA01G43435.15e-33(Glycine max)
STRINGGLYMA11G02061.12e-32(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF35832757
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53200.12e-31MYB_related family protein
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]